RapidDNS Rocket Illustration
2a06:98c1:3120::
Total: 4611835
Limited Access: You are using RapidDNS as a guest. Login with GitHub to unlock more features and higher query limits. View Plans
Export feature requires Pro or Max membership
# Domain Address Type Date
1 3570.flowhot.cc 2a06:98c1:3120:: AAAA 2026-03-03
2 www.saveotmoor.org 2a06:98c1:3120:: AAAA 2026-03-03
3 www.iphones-apps.ru 2a06:98c1:3120:: AAAA 2026-03-03
4 www.pinnbet.com.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
5 bot.modryzabiak.sk 2a06:98c1:3120:: AAAA 2026-03-03
6 mail.sananwin.pw 2a06:98c1:3120:: AAAA 2026-03-03
7 autodiscover.viaggiare-low-cost.it 2a06:98c1:3120:: AAAA 2026-03-03
8 rde.com.br 2a06:98c1:3120:: AAAA 2026-03-03
9 www.ygbxtj.cn 2a06:98c1:3120:: AAAA 2026-03-03
10 kourim.alpakashop.cz 2a06:98c1:3120:: AAAA 2026-03-03
11 bolsosycomplementos.es 2a06:98c1:3120:: AAAA 2026-03-03
12 129334.flowhot.cc 2a06:98c1:3120:: AAAA 2026-03-03
13 www.seksist.com.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
14 www.poland.gow.pl 2a06:98c1:3120:: AAAA 2026-03-03
15 www.sfpg.org.pl 2a06:98c1:3120:: AAAA 2026-03-03
16 himself.co.uk 2a06:98c1:3120:: AAAA 2026-03-03
17 uwaga.tvn.pl.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
18 pecuk.tulungagungdaring.id 2a06:98c1:3120:: AAAA 2026-03-03
19 www.browndlp.org 2a06:98c1:3120:: AAAA 2026-03-03
20 cpcontacts.mothersanddaughters.in 2a06:98c1:3120:: AAAA 2026-03-03
21 dutchovenguide.eu 2a06:98c1:3120:: AAAA 2026-03-03
22 smtp.oasishealth.ca 2a06:98c1:3120:: AAAA 2026-03-03
23 b.comejo.in 2a06:98c1:3120:: AAAA 2026-03-03
24 www.smp.ums.edu.my.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
25 www.epti.co.id 2a06:98c1:3120:: AAAA 2026-03-03
26 www.sessogarantito.com.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
27 escommunication.org 2a06:98c1:3120:: AAAA 2026-03-03
28 edufuturo.com.br 2a06:98c1:3120:: AAAA 2026-03-03
29 dzik.it 2a06:98c1:3120:: AAAA 2026-03-03
30 fh-uni.eu 2a06:98c1:3120:: AAAA 2026-03-03
31 digitnet.nl 2a06:98c1:3120:: AAAA 2026-03-03
32 ilmediterraneo.org 2a06:98c1:3120:: AAAA 2026-03-03
33 vidobet.org 2a06:98c1:3120:: AAAA 2026-03-03
34 truefone.org 2a06:98c1:3120:: AAAA 2026-03-03
35 e-ambalaj.ro 2a06:98c1:3120:: AAAA 2026-03-03
36 url.bryggensbaadelaug.dk 2a06:98c1:3120:: AAAA 2026-03-03
37 tutteo.io 2a06:98c1:3120:: AAAA 2026-03-03
38 unicoeventos.com.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
39 esresponsable.org 2a06:98c1:3120:: AAAA 2026-03-03
40 www.51diy.ca 2a06:98c1:3120:: AAAA 2026-03-03
41 saudiairlines.com.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
42 notacartel.business 2a06:98c1:3120:: AAAA 2026-03-03
43 www.kenningtonps.vic.edu.au 2a06:98c1:3120:: AAAA 2026-03-03
44 klaudynka-kolczyki.flog.pl 2a06:98c1:3120:: AAAA 2026-03-03
45 valueconveyancer.co.uk 2a06:98c1:3120:: AAAA 2026-03-03
46 westbrattleboro.org 2a06:98c1:3120:: AAAA 2026-03-03
47 tim.paib.ca 2a06:98c1:3120:: AAAA 2026-03-03
48 www.wellingtonlaparoscopy.co.nz 2a06:98c1:3120:: AAAA 2026-03-03
49 wingswithinfoundation.org 2a06:98c1:3120:: AAAA 2026-03-03
50 where-to-go.info 2a06:98c1:3120:: AAAA 2026-03-03
51 www.ets-navatel.fr 2a06:98c1:3120:: AAAA 2026-03-03
52 www.filmovidownload.blogger.ba.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
53 www.hetnationaalhoorspel.nl 2a06:98c1:3120:: AAAA 2026-03-03
54 compugamestv.com.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
55 cpanel.lvnprograms.org 2a06:98c1:3120:: AAAA 2026-03-03
56 paullang.dev 2a06:98c1:3120:: AAAA 2026-03-03
57 www.gadarian.com.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
58 www.hairphilosophy.gr 2a06:98c1:3120:: AAAA 2026-03-03
59 easyurl.io 2a06:98c1:3120:: AAAA 2026-03-03
60 cnjmi.cn 2a06:98c1:3120:: AAAA 2026-03-03
61 olga18.est.ua 2a06:98c1:3120:: AAAA 2026-03-03
62 cooperstown.pennsylvaniaonline.us 2a06:98c1:3120:: AAAA 2026-03-03
63 conozcasucanton.com.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
64 coop-land.ru.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
65 p-svetlana.greenlist.kz 2a06:98c1:3120:: AAAA 2026-03-03
66 seotest.cz 2a06:98c1:3120:: AAAA 2026-03-03
67 www.gzshunma.cn 2a06:98c1:3120:: AAAA 2026-03-03
68 zhosa.cz 2a06:98c1:3120:: AAAA 2026-03-03
69 osservatoriopedofilia.gov.it.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
70 www.moto-dakar.eu 2a06:98c1:3120:: AAAA 2026-03-03
71 contact-voyant.fr.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
72 cpanel.tokowifi.id 2a06:98c1:3120:: AAAA 2026-03-03
73 cpanel.emergencyservicesafterhours.co.uk 2a06:98c1:3120:: AAAA 2026-03-03
74 packageheroes.fi 2a06:98c1:3120:: AAAA 2026-03-03
75 dwightschooldubai.ae 2a06:98c1:3120:: AAAA 2026-03-03
76 analytics.tech-mc.de 2a06:98c1:3120:: AAAA 2026-03-03
77 www.skatlica.si 2a06:98c1:3120:: AAAA 2026-03-03
78 mail.streamgear.co.uk 2a06:98c1:3120:: AAAA 2026-03-03
79 hanningtons.co.uk 2a06:98c1:3120:: AAAA 2026-03-03
80 www.vasrelax.cz 2a06:98c1:3120:: AAAA 2026-03-03
81 www.unitedway4u.org 2a06:98c1:3120:: AAAA 2026-03-03
82 increshosting.nl 2a06:98c1:3120:: AAAA 2026-03-03
83 mail.kenresearch.ae 2a06:98c1:3120:: AAAA 2026-03-03
84 porchlighthub.store 2a06:98c1:3120:: AAAA 2026-03-03
85 malgo.io 2a06:98c1:3120:: AAAA 2026-03-03
86 mail.hellopersian.eu 2a06:98c1:3120:: AAAA 2026-03-03
87 mail.newdawnstudio.ru 2a06:98c1:3120:: AAAA 2026-03-03
88 mail.pegasus-cph.dk 2a06:98c1:3120:: AAAA 2026-03-03
89 petraslamova.cz 2a06:98c1:3120:: AAAA 2026-03-03
90 1avtorem.ru 2a06:98c1:3120:: AAAA 2026-03-03
91 www.kalman.nu 2a06:98c1:3120:: AAAA 2026-03-03
92 www.mita08.cn 2a06:98c1:3120:: AAAA 2026-03-03
93 turkije.shirt-voordeel.nl 2a06:98c1:3120:: AAAA 2026-03-03
94 maharatamulet.com.webstatsdomain.org 2a06:98c1:3120:: AAAA 2026-03-03
95 madaracosmetics.cz 2a06:98c1:3120:: AAAA 2026-03-03
96 www.oratoriosocietyofny.org 2a06:98c1:3120:: AAAA 2026-03-03
97 balashovchess.ru 2a06:98c1:3120:: AAAA 2026-03-03
98 carmudi.lk 2a06:98c1:3120:: AAAA 2026-03-03
99 www.fvmin.cl 2a06:98c1:3120:: AAAA 2026-03-03
100 bhavnagarmandir.org 2a06:98c1:3120:: AAAA 2026-03-03
RapidDNS Database Statistics

Rapiddns has 8 billion DNS data and supports 4 DNS types

Rapiddns currently has more than 8 billion DNS resolution data, supporting A, CNAME, AAAA, MX types. A records 5.1 billion, CNAME records 985 million, AAAA records 1.7 billion and MX records 1.1 billion. Can query the domain name of the same IP website (support IPv6). You can also query subdomain information.