Total: 3319019
| # | Domain | Address | Type | Date |
|---|---|---|---|---|
| 1 | download-do-livro-vencend22848.affiliatblogger.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 2 | damienhmnpp.affiliatblogger.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 3 | dandmelectrical.com.au | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 4 | devinttqjc.collectblogs.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 5 | www.bag-boys.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 6 | www.arti.co.il | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 7 | sidac.ie | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 8 | cpcalendars.clean852.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 9 | brucereichstein.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 10 | chungcuathenacomplexs.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 11 | businessblog.jeeran.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 12 | ads-b.winsite.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 13 | lacecamisole38494.thezenweb.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 14 | www.bt365zz.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 15 | kylernmkhe.affiliatblogger.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 16 | luxuryluvxxx.myseostats.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 17 | zettelwirtschaften.stempelkarte24.de | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 18 | yzngxa308.g806.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 19 | zebnet-backup-for-em-client-free-edition.windows10compatible.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 20 | domino88x.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 21 | decks30739.jiliblog.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 22 | deanidzu26159.affiliatblogger.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 23 | ww1.perfectapp.biz | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 24 | army-photo-gallery.blog.hr | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 25 | dentonwebdesign53085.affiliatblogger.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 26 | dallasyvofx.diowebhost.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 27 | donovandbzxu.timeblog.net | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 28 | demarcus65u.affiliatblogger.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 29 | zzbqm.eu.org | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 30 | lee-county-ia.clients.municipalone.cloud | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 31 | 076h.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 32 | zongyidaremen20131010.971z.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 33 | sem-sunderland72182.mybjjblog.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 34 | ftp.consultemdc.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 35 | www.wpninjadojo.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 36 | best-inexpensive-microwave.blog.hr | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 37 | prolaundry.demo.site | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 38 | professionalguttercleanin99764.jaiblogs.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 39 | primnotes.com.clearwebstats.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 40 | pos.soappchat.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 41 | preventivepestcontrol62085.ka-blogs.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 42 | programming-project-help35929.onesmablog.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 43 | psicologaleone.myadj.it | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 44 | poufpillowshop.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 45 | quiviratailor.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 46 | bltbuy.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 47 | cjman.cn | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 48 | czrvha9.r970.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 49 | cpcalendars.gillinghambest.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 50 | www.careersatkmwe.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 51 | hoteltoscana.co.kr | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 52 | hairloss-blocker-funciona84062.onesmablog.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 53 | guttercleaning86295.thezenweb.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 54 | artwithme.org | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 55 | knicholsstudio.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 56 | yinghuangguojiyulehuisuo.w10.lyjiayifa.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 57 | pozew-rozwodowy692.isblog.net | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 58 | blog.kidfuse.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 59 | www.lbcmarketing.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 60 | xfactorservers.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 61 | propsyche.pl.clearwebstats.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 62 | qmssoftwareformedicaldevi41840.diowebhost.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 63 | psychiatristsnearlivingst26048.dbblog.net | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 64 | rafaeluityi.affiliatblogger.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 65 | realtor6ao.diowebhost.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 66 | pahoa.sch.id | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 67 | plantwovote.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 68 | revauction.io | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 69 | support.viralaccounts.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 70 | www.pacificnetworks.net | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 71 | bal10yrs.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 72 | contemporary-edge.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 73 | www.portugalgoldenvisass.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 74 | militopagliara.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 75 | raymondxfyoc.ezblogz.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 76 | brandfabric.net | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 77 | _mta-sts.mail.icyrelic.net | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 78 | 88523.net | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 79 | kylermevmc.thezenweb.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 80 | potigny.fr | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 81 | kelemehlib.blogfa.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 82 | lasai-table-and-container61605.pages10.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 83 | kameronxvpkd.pages10.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 84 | programming-assignment-he27147.dbblog.net | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 85 | protokol.dev | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 86 | juliusgjdy481.onesmablog.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 87 | principaleconomics.co.nz | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 88 | kharkov.afisha-ua.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 89 | quizgame.laurajswan.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 90 | prosersade43074.blogkoo.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 91 | pulseoflove.mandygirls.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 92 | profiles.abdental.com.au | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 93 | purchaseskincare39517.alltdesign.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 94 | qmslw.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 95 | qy8.top | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 96 | reidxfjnp.collectblogs.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 97 | samantaroy.livesex-news.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 98 | sdbuildout.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 99 | autodiscover.findophold.dk | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |
| 100 | auto-repair-austin98539.pages10.com | 2a06:98c1:3121::2 | AAAA | 2025-10-27 |